True's beaked whale.jpg

Western spotted skunk

Hooded skunk

Yellow-throated Marten

Wolverine

Archive for the ‘Science’ Category

Water on the moon!

Monday, November 16th, 2009

Last October, NASA’s LCROSS mission slammed a spent rocket booster then the LCROSS spacecraft itself into the moon. No debris plume was seen from Earth, but observations from LCROSS of the booster hitting indicate the presence of water on the moon. How much water? Most news accounts don’t say, but the Science magazine article does.

100 kilograms of water was detected from an impact that created a crater estimated to be 20 m wide and 3 meters deep. So 100 kg water in about 500 m3 of regolith = 0.1 g/kg. (Googled a reference giving 2.3 to 2.6 g/cm3 as lunar regolith density).

The article gives a higher estimate for water, 0.1% to 10%, higher than my crude 0.01% estimate. Which is great–enough water to extract easily and live off. Best news for space exploration in thirty years!

LCROSS impact plume
(Credit: NASA)

Evolution of the glucocorticoid receptor

Wednesday, October 21st, 2009

Interesting letter about the evolution of the glucocorticoid receptor from Joe Thornton, a biologist at the University of Oregon. Thornton’s lab has figured out some of the details on how this receptor evolved. Thornton’s writing this because creationist Behe is passing off a mangled version of his work as evidence for ‘intelligent design’.

The first Discover magazine blog post gives a good overview of what Thornton’s lab learned about the glucocorticoid receptor.

GR receptor pathway

Mouse coat colors

Tuesday, October 13th, 2009

Here’s a web page at the The Jackson Labs site showing the most common mouse coat color mutations [link].

Here is white-bellied agouti with head blaze, greyish coat:

white-bellied agouti

Ebola

Monday, October 12th, 2009

In a passing during a discussion of the lack of a system for naming viral strains and diseases, Greg Laden mentions that Ebola was named after the town in Zaire/Congo where it was first found.

That has to depress the local real estate market!

Bird flu–humanity gets lucky

Sunday, October 4th, 2009

H1N1 flu is going around this year, an especially bad flu to which few people under 35 have much immunity. A bad flu year, but not in the same class as the 1918 flu.

The bird flu had potential to be very deadly, potentially as bad as the 1918 flu. The bird flu, an avian influenza A (H5N1) virus strain that emerged in Asia in 2003 had potential to turn into a very deadly human flu. A flu virus emerged that spread as an epidemic in birds or several species. Then it passed to humans–several times–and was very deadly, 60% fatal. While deadly, the virus that humans got was either wouldn’t transmit between people or did so only with great difficulty. Small clusters of people, usually of families that worked or lived with birds, came down with bird flu.

Bird flu needed only one or two mutations to become capable of causing a worldwide pandemic. It needed to pick up the property of easy contagion, human-human transmission. The first steps to contain bird flu in Asia failed. It spread around the world in wild and domestic bird populations and sometimes infected other animals. It has become endemic in bird populations this gives the virus many opportunities to infect humans and pick up mutations to allow it to spread in people.

Flu virus particle

So far we’ve been lucky, and the H5N1 avian influenza hasn’t turned into a fast spreading human flu epidemic. Perhaps this flu virus is a dead end of sorts and is incapable of jumping to humans. It does keep getting chances and infecting the occasional person so the CDC and WHO continue to monitor it. It has had many chances to become a human epidemic and so far hasn’t, and as time it becomes less likely to jump to humans. It looks like we got lucky.

We didn’t get so lucky with the capacitor plague…

Spenceriella gigantea

Wednesday, September 16th, 2009

I want a pet book worm!

The North Auckland worm, Spenceriella gigantea, reportedly glows in the dark brightly enough to read by!

Spenceriella gigantea

Soft tissue in dinosaur fossils

Tuesday, September 15th, 2009

In 2005, a Schweitzer et al. reported that they had found soft tissue in the marrow of a T. rex. bone. Examination of the tissue showed evidence of cell-like structures that could indicate preserved cells. Also stuff was squishy like protein. It if held up, an incredible discovery.

In 2007, Schweitzer et al. followed it up with more extensive analysis that indicated the presence of collagen I protein. Most exciting, they used mass spec to sequence a few fragments of dinosaur protein. It was quite similar to chicken collagen, and of course birds are the closest living relatives of dinosaurs.

Then in 2008, Kaye et al. analyzed a number of fossils and found similar traces, but interpreted them as bacterial colonies, as biofilm. They even saw the cell-like traces in a fossil ammonite, a creature without blood cells.

This year, Schweitzer et al. doubled down, publishing collagen I protein sequence from a hadrosaur.

hadrosaur

In total the two papers found protein sequences that cover 169 aa of collagen protein sequence. Here are the overlapping dinosaur sequences with the gaps removed aligned to chicken sequence. The dinosaur sequences differ from the chicken sequence at five positions.

It will be interesting to see if these results hold up. I would like to see replication by a second lab. Most convincing would be two labs given the same unknown sample and both finding the same new collagen protein sequence.


>Tyrannosaurus rex
>Gallus gallus
>Brachylophosaurus
GATGAPGIAGAPGFPGARGAPGPQGPSGAPGPKGVQGPPGPQGP--------------------------
GATGAPGIAGAPGFPGARGPSGPQGPSGAPGPKGVQGPPGPQGPRGLTGPIGPPGPAGAPGDKGEAGPPG
GATGAPGIAGAPGFPGARGPSGPQGPSGAPGPKGVQGPPGPQGPRGLTGPIGPPGPAGAPGDKGEAGPSG
                   **                                               * 

--------RGSAGPPGATGFPGAAGRGVVGLPGQR-----------------------------------
PAGPTGARRGSAGPPGATGFPGAAGRGVVGLPGQRGETGPAGPAGPPGPAGARGSNGEPGSAGPPGPAGL
PPGPTGAR-GSAGPPGATGFPGAAGR---------GETGPAGPAGPPGPAGARGSNGEPGSAGPPGPAGL
 *

-GLPGESGAVGPAGPPGSR
RGLPGESGAVGPAGPIGSR
RGLPGESGAVGPAGPPGSR
               *  

An odd corner of the human fertility industry

Friday, August 28th, 2009

Putting together the reading list for the seminar class this semester I ran across an odd corner of the human fertility industry that I never knew existed. I’m picking seminal papers in biotechnology and one of them is the 1992 paper, “Birth of a normal girl after in vitro fertilization and preimplantation diagnostic testing for cystic fibrosis” by Handyside et al. One of a pair of papers that first used PCR to test embryos for genetic disease so that the disease free ones can be implanted.

So I looked at where preimplantation diagnostic testing was available in Lexington. There is an IVF clinic that does preimplantation testing–not at the UK hospital, they seem shy of anything slightly controversial. What was odd, is ZDL, a company that sells fertility products for people to use at home, or send in for analysis. Home sperm counts, insemination devices, and more. Quite surprising!

Insemination device

Appendix Two to Darwin’s The Voyage of the Beagle

Thursday, July 30th, 2009

H.M.S. Beagle

A was listening to Charles Darwin’s The Voyage of the Beagle, an incredible story of a round the world voyage of exploration that began in 1831 and continued for five years.

The end of the edition I was listening to had two appendices, the first being nautical stuff about the trip and the second being a reprint of the ship captain Robert Fitz Roy’s “Remarks with reference to the Deluge”. It’s basically a argument for literal biblical creationism by Fitz Roy, and it was pretty ironic to find it tacked on to the Voyage. I don’t know the which editions carried it, apparently the Voyage was published in several editions (wikipedia).

The strangest part of Fitz Roy’s argument was his attempt to describe a plausible way that the biblical Deluge, the business with the Ark and world covered by water, could have deposited the many layers of rock and sediment that compose the geological record and which he observed at locations around the globe. In his argument he mentions that the Library of Useful Knowledge, 1829 describes an experiment by Perkins that showed that at a depth of 3000 feet, water is compressed to 1/27 of its volume at the surface. Fitz Roy relates this to a sailor’s experience that in determining depth with a weight and a line, larger weights are required for deeper depths.

Fitz Roy then argues that sea water is very dense in the ocean depths, and that all sorts of objects immersed during the Deluge would sink to a depth where the water was dense enough to make then buoyant, different objects finding a different natural depth, and that these layers would be preserved as the Deluge ebbed.

This is quite remarkable. Water is known now to be nearly incompressible, around 2% at the bottom of the ocean, with the slight changes in ocean water density caused more by temperature and salinity than pressure. This means that Fitz Roy’s argument falls apart. More remarkable is that such a basic fact about water and the oceans was unknown in the 1830’s. Fitz Roy really believed there was a depth in the ocean where cannon balls float, accumulated from the world’s shipwrecks and banging around together in a layer where iron floats in the deep ocean.

Sequencing every species on the planet

Sunday, July 12th, 2009

With next generation sequencing technologies that have become available over the last two years, there is enough DNA sequencing machines that their combined capacity is, at a guesstimate, about 30,000 Gb per year.

How much DNA sequencing is that? Enough to sequence the genomes of 10,000 people per year. In other terms, enough capacity today to sequence every bacteria and virus species in a single year, or every the genome of every species on the planet in 300 years, bacterial genomes being small.

The sequencing technology is improving at a fast clip and I expect that in ten years or so it will be 1000X better (faster and higher capacity sequencing machines). So in ten years, it will be possible to sequence every species on the planet in a single year.