True's beaked whale.jpg

Western spotted skunk

Hooded skunk

Yellow-throated Marten

Wolverine

Author Archive

Creationism talk by Dave Eakin

Thursday, October 1st, 2009

A UK Bible study group hosted a talk tonight by Dave Eakin, an Associate Professor in the Department of Biological Sciences at Eastern Kentucky University (EKU). I didn’t know quite what to expect coming in to the talk–was Eakin going to explain some biology to the Bible study group or was this going to be bog standard creationism? The talk turned out to be standard old Earth creationism. What an embarrassment he is to EKU!

An MP3 recording of the talk is available here.

I made notes during the talk, they give a flavor for it. My comments are in brackets:

3 groups: biblers, people with set minds…

Comments about apoliticalness and open mindedness.

Cartoon: candle representing science, “Hit it with the Bible”.

Chain of being cartoon.
He mentions he had a creationisty poster at the KAS meeting and no one gave him guff about it.

3 theories of evolution:
1. chemical evolution (abiogenesis)
2. general evolution “an extrapolation of Darwin’s natural selection”
3. natural evolution = special evolution [seems to be a ref to microevolution]

Behe’s Black Box book. [Darwin’s black box: the biochemical challenge to evolution
By Michael J. Behe]

It’s hard to tell if things are designed.
Creationists are blackballed, McCarthyism-type environment for creationists.

Paley-like are arguments are too simple/wrong, but Behe is more sophisticated [not clear how].
Watch, mouse trap, flagellum
[clotting cascade, eye, Krebs]
Eye
Trials for cats. [????]

Graduate of U. of Louisville! [figures!]

No one can solve these problems

Color blindness slide?
Can make it clear by increasing contrast…
“Evidence doesn’t support theories, theories support evidence” –Dr Dave.
Big Bang not current, has been replaced by String Theory

CSI example, making the point that evidence can be made to support whatever theory a person wants.

If 60,000 people believe a lie, it’s still a lie.

All his sick evolutionist friends ask him to pray for them.

Quote: when fossils are known all no more guessing. [missed the cite]

We doesn’t know everything so we know nothing.

Absence of life in pre-Cambrian, organisms suddenly appear, and…

Picture of single-celled microfossils, asks if anyone believes them.
Makes fun of certainty of Ph.Ds.

Something new from Discover mag, image of tree of life from single-celled organism.
Pisoliths from pre-oxy atmosphere Earth (pre 2.3 billion years), but they only occur in presence of oxy.
[Casting doubt on what we know.]

Stephen Jay Gould had a young Earth Creationist student. [meaning unclear…]
Quote from Gould, from Evolution’s Erratic Pace, Natural Hist May 1977, at 12, 14. about no transitional forms.

Erase all the lines from tree of life because we don’t know anything for sure.

Never presented Creationism in class. Wants student to think for themselves.
Quote from Colin Patterson (April 10, 1979) on how we don’t have any transitional fossils.
Quote by Tom Bethell in Harper’s February on how no one is willing to publicly talk about ‘questions’.

But what about Archaeopteryx? Small, unimportant. Just a reptile.
Eakin has reviewed many/most biology textbooks.
Says Archaeopteryx is often misrepresented, over interpreted.

Some point about lack of learned behavior in reptiles.
Figures of bird physiology. Pectoral muscles in bird/reptiles.

How did scales evolve into feathers? Unknown, too hard to imagine. [Evo-dev has been providing answers about this.]

How did birds start to fly? An irreducible jump.
We know in our hearts that transitional forms can’t happen.

Faith is… “the substance of things hoped for, the evidence of things not seen.”

My battery ran down at this point and the sound cut off the last minute or two of his talk and the extended Q&A afterward. He mentioned the audience was very respectful and had given him his say. Bible groups must usually be a rough audience!

In the Q&A, he also said that he had talked to many biologists and that 10-20% were creationists of some variety but unwilling to publicly talk about it. This is quite silly, an argument from popularity. Also it’s nonsense. Anonymous surveys of biologists have been done and almost no biologists are creationists. A 1987 Newsweek article reports a survey found 0.14% of earth scientists and biologists are creationists, and a survey reported in CSI pegs the number at 1-2 in about 2000, about 0.1%.

It was sad to find out that EKU has a creationist teaching biology. Oh, the poorly served students!

Most surprising was that Eakin gave his whole talk without ever describing the theory of evolution, in any of its forms, either the simple Darwinian version or the Modern Synthesis. His talk was instead the poorly thought out basket of criticisms of evolution with no case made for anything else. I’ve heard this described as common in creationist talks.

Eakin started his talk saying that evidence is never conclusive, that there’s always doubt, and that we can’t be sure of anything. I thought that would be the theme of his talk before he swerved into ordinary creationism.

Eakin’s talk was at least a decade out of date. One topic was Behe’s book and the argument of ‘irreducible complexity’. Eakin doesn’t seem to know that Behe’s featured examples, the flagellum and the eye, have been shown to have evolutionary precursors where part of the ‘irreducible’ structure exists and functions.

Eakin mentions Archaeopteryx and then makes an extended argument that the evolution of reptile ancestors into birds is impossible but doesn’t seem to know that additional transitional birds have been discovered, or the recent evidence of the relationship between scales and feathers.

Eakin also briefly mentioned his impression that few transitional horse fossils are known, and mentioned that the linear, gradual depiction of horse evolution was admitted by biologists to be false. This hoary creationist canard leaves so much out as to be plain dishonest. Eakin should known better.

In the early part of the 20th century, depictions of horse evolution presented a linear, gradual picture of horse evolution, but soon after more and more horse fossils were discovered and filled in a picture of horse evolution as a branching bush with over a score of Genera, many coexisting and all but a few now extinct. Talkorigins.org has a good page on this, though Stephen Jay Gould’s essay “Life’s Little Joke” collected in Bully for Brontosaurus is a better read. There are many transitional horse fossils, and the branching tree of horse evolution has been widely known for 70+ years.

The talk ended with a series of quotes from evolutionary biologists about the lack of transitional fossils and the difficulty of drawing conclusions. This was standard creationist quote mining, quite a laugh.

Eakin is a graduate of U of L. I know that won’t surprise anyone at UK.

Where’s Phil Agre?

Thursday, October 1st, 2009

Phil Agre ran the Red Rock Eater mailing list for many years, it was active during the 90’s. I think I started reading it in the late 90’s. The emails ran down to a trickle in 2002, in part I think due to Phil getting a permanent position at UCLA. The mailing list archive indicates it ran up to Jan 2005.

Phil Agre’s mailing list in essence was one of the first blogs. The content was mainly links and commentary by Phil with occasional longer essays. He was one of the best people thinking about what the internet could be used for and how it was changing the world.

After 2002, the Red Rock Eater list went into abeyance then seemed to have stopped for good. Phil Agre seems to have dropped off the net. In this comment thread a UCLA student says he was ill. I fear it is very serious to keep him off line so long.

His essays, “Advice for undergraduates considering graduate school” and “How to be a leader in your field” are internet classics.

Here is an essay I found interesting titled What Is Conservatism and What Is Wrong with It?

Update: He’s literally missing. This site is run by friends looking for him.
Update 1/31/09: UCLA police talked with him. He’s alive, though not well.

The lost decade, or thanks for nothing!

Friday, September 25th, 2009

Census data on median income change between 2000 and 2008 by way of USA Today:

Median income 2000-8

US GDP in constant dollars per capita grew 9.7% over this period, so the country grew 10% richer and if it was distributed evenly everyone’s income would have grown roughly 10%. But not–instead most of the $$ went to a small slice of the population, and that doesn’t show up in this table.

My senator, Jim Bunning (R)

Wednesday, September 23rd, 2009

This is why they call him “Silent” Jim Bunning.

Bunning snoozing

Picture taken at a Senate committee meeting working on the health care bill.

Book review: The Atrocity Archives and Concrete Jungle by Charles Stross

Tuesday, September 22nd, 2009

Atrocity Archives word cloud

Charles Stross has written the best new books I’ve read over the past few years.
Singularity Sky, Accelerando, Halting State, each excellent. And his books explore different ideas and are set in very different worlds. With the exception of the dismal Family Trade series, his writing has been excellent.

The Atrocity Archives and Concrete Jungle, two shorter works set in the same world are the first fantasy I’ve read by him, and they are crazy good. Halting State good, but these stories are modern fantasy integrated into the technological world, magic for hackers that participates in the modern world revolutionized by discoveries in mathematics, electronics, modern physics, and computers. A magical worldview that has confronted modern physics and considered the natural consequences of computers.

The book was a real page turner–errr, a virtual page turner that I read on computer. The Atrocity Archives is better than Concrete Jungle. Jungle seems constrained by its short length, the ending feels rushed. After Concrete Jungle I immediately sought a sequel and was glad to find The Jennifer Morgue.

Concrete Jungle word cloud

Spenceriella gigantea

Wednesday, September 16th, 2009

I want a pet book worm!

The North Auckland worm, Spenceriella gigantea, reportedly glows in the dark brightly enough to read by!

Spenceriella gigantea

Soft tissue in dinosaur fossils

Tuesday, September 15th, 2009

In 2005, a Schweitzer et al. reported that they had found soft tissue in the marrow of a T. rex. bone. Examination of the tissue showed evidence of cell-like structures that could indicate preserved cells. Also stuff was squishy like protein. It if held up, an incredible discovery.

In 2007, Schweitzer et al. followed it up with more extensive analysis that indicated the presence of collagen I protein. Most exciting, they used mass spec to sequence a few fragments of dinosaur protein. It was quite similar to chicken collagen, and of course birds are the closest living relatives of dinosaurs.

Then in 2008, Kaye et al. analyzed a number of fossils and found similar traces, but interpreted them as bacterial colonies, as biofilm. They even saw the cell-like traces in a fossil ammonite, a creature without blood cells.

This year, Schweitzer et al. doubled down, publishing collagen I protein sequence from a hadrosaur.

hadrosaur

In total the two papers found protein sequences that cover 169 aa of collagen protein sequence. Here are the overlapping dinosaur sequences with the gaps removed aligned to chicken sequence. The dinosaur sequences differ from the chicken sequence at five positions.

It will be interesting to see if these results hold up. I would like to see replication by a second lab. Most convincing would be two labs given the same unknown sample and both finding the same new collagen protein sequence.


>Tyrannosaurus rex
>Gallus gallus
>Brachylophosaurus
GATGAPGIAGAPGFPGARGAPGPQGPSGAPGPKGVQGPPGPQGP--------------------------
GATGAPGIAGAPGFPGARGPSGPQGPSGAPGPKGVQGPPGPQGPRGLTGPIGPPGPAGAPGDKGEAGPPG
GATGAPGIAGAPGFPGARGPSGPQGPSGAPGPKGVQGPPGPQGPRGLTGPIGPPGPAGAPGDKGEAGPSG
                   **                                               * 

--------RGSAGPPGATGFPGAAGRGVVGLPGQR-----------------------------------
PAGPTGARRGSAGPPGATGFPGAAGRGVVGLPGQRGETGPAGPAGPPGPAGARGSNGEPGSAGPPGPAGL
PPGPTGAR-GSAGPPGATGFPGAAGR---------GETGPAGPAGPPGPAGARGSNGEPGSAGPPGPAGL
 *

-GLPGESGAVGPAGPPGSR
RGLPGESGAVGPAGPIGSR
RGLPGESGAVGPAGPPGSR
               *  

Book review: Jurassic Park by Michael Crichton

Monday, September 14th, 2009

I finally read the iconic dinosaur book by Michael Crichton. The book was very similar to the movie, closer than any other movie I’ve seen. In many ways the book reads as if it was written with the idea of turning it into a movie in mind. The plot is straightforward: rich old guy hires scientists to recreate dinosaurs from DNA preserved in fossils, then the dinosaurs get loose and eat people.

The science fiction idea than spawned the book is grand. Recreating dinosaurs! Real dinosaurs! That people can be see and watch and eventually run screaming from. The other part of the book, the horror movie bolt on plot, is naturally fit for a movie.

Surprisingly there isn’t much more to the book than what’s in the movie. And unfortunately the worst parts of the movie are the author’s invention. The ‘mathematician’ character, spouting ridiculous idea that chaos theory proves everything will go wrong and fall apart is all the author’s. Also, the annoying younger sister who alternates between fear, whining, and suicidal stupidity is all Crichton. She’s written worse in the book, the other characters mock whatever she has to say and keep telling her to shut up. The out of nowhere scene in the movie where she pops up as a computer system expert looks added in an attempt to give her character a positive side.

Still, dinosaurs!

cover pic

When the book was written, it was plausible to speculate that fossils millions of years old would contain bits of DNA. As it turns out, DNA degrades over hundreds of thousands of years, and no DNA has been recovered from samples millions of years old. In fact, chemical studies predict that DNA will degrade at such a rate that no original DNA remains in samples millions of years old. Today, alas, it seems unlikely that dinosaur DNA sequences will ever be recovered.

Jurassic Park word cloud

I am surfeit with hard drive capacity

Wednesday, September 2nd, 2009

Two terabyte hard drives were recently released, which to me means the day is nearing where a single computer with have all the storage space I can imagine ever using. This figures a typical computer with four hard drives. Here’s how I apportion a my complete storage needs:

1 TB, 100,000 books x 10 MB each, every book of which I’ve ever heard (or read).
1 TB, one million photos x 1 MB each, a lifetime of pictures and LOLcats.
1 TB, 200,000 songs x 5 MB each, every song I’ll every hear in my life.
7 TB, 200 TV shows x 50 episodes x 700 MB, complete runs for typical hour long TV shows.
12 TB, 3,000 movies x 4 GB each, one new movie a week for life.
——————————————————————————————-
Total: 20 TB

Four 5 TB drives add up to 20 TB, and 5 TB drives should be available in about 2-3 years. Backup and redundancy require extra storage not accounted for here, but becoming progressively easier.

As you can see, books and even audio are only a small fraction of the storage space. Start with a smaller video library–movies and TV seen so far, or only favorites–and four 2 TB drives would satisfy all personal storage requirements.

To use more personal storage someone needs to make some sort of digital diary, an elog, a continuous lifetime audio or video record.

An odd corner of the human fertility industry

Friday, August 28th, 2009

Putting together the reading list for the seminar class this semester I ran across an odd corner of the human fertility industry that I never knew existed. I’m picking seminal papers in biotechnology and one of them is the 1992 paper, “Birth of a normal girl after in vitro fertilization and preimplantation diagnostic testing for cystic fibrosis” by Handyside et al. One of a pair of papers that first used PCR to test embryos for genetic disease so that the disease free ones can be implanted.

So I looked at where preimplantation diagnostic testing was available in Lexington. There is an IVF clinic that does preimplantation testing–not at the UK hospital, they seem shy of anything slightly controversial. What was odd, is ZDL, a company that sells fertility products for people to use at home, or send in for analysis. Home sperm counts, insemination devices, and more. Quite surprising!

Insemination device